Free US standard shipping on orders over $150
Research Compound Reference

B7-33

Molecular Profile

Compound

B7-33

CAS number

1818415-56-3

Molecular formula

C131H229N41O36S

Molecular weight

2986.5 g/mol

Amino acid sequence

VIKLSGRELVRAQIAISGMSTWSKRSL-NH2

Purity

greater than 99 percent

Physical form

Lyophilized powder

Synthesis route

Solid-phase peptide synthesis

What B7-33 is, structurally

The specification here is internally consistent, which is worth confirming rather than assuming. The stated formula, C131H229N41O36S, computes to an average mass of 2986.58 against a stated 2986.5, agreeing to within rounding. That figure is what a mass measurement should be compared against.

That check is worth performing rather than assuming. A formula and a weight are independent statements about the same molecule, so comparing one against the other tests a specification from the inside, without reference to any outside source. The deposited record for this CAS agrees independently, giving the same formula, so two separate lines support the figures above.

Beyond that the formula is informative in the ordinary way. Forty-one nitrogens across a molecule of this mass is about one per 73 daltons, a nitrogen-rich composition indicating abundant basic side chains; an acidic peptide of similar size runs closer to one per 94. Thirty-six oxygens gives one per 83, which is unremarkable. The molecule should therefore carry net positive charge at neutral pH and have a high isoelectric point.

That bears directly on dissolution. A basic peptide becomes more charged, and so more soluble, as pH falls, so mildly acidic conditions assist rather than hinder it. The opposite applies to acidic peptides, so the direction is worth being deliberate about.

There is a single sulfur, one short of what an intramolecular disulfide requires, so no internal bridge can form. The formula alone cannot say what the atom is, since a methionine thioether and a free cysteine thiol both fit it, but the stated sequence settles it: a methionine is present and no cysteine appears anywhere in the chain. The liability is therefore oxidation to the sulfoxide, adding sixteen units, and the dimerisation route a free thiol would open does not exist here.

Reconstitution and handling

Sterile water is the default solvent. Where a vial dissolves reluctantly, mildly acidic conditions are the right escalation for a basic peptide, dilute acetic acid being conventional.

Add diluent slowly down the inside wall of the vial, swirl gently, and let the solution clarify. Do not vortex; it introduces foam without dissolving anything faster.

No reducing agent is required, since no internal disulfide can exist. The single sulfur belongs to the methionine, so limiting air contact guards against oxidation to the sulfoxide rather than against any thiol chemistry.

Adsorption deserves attention on a basic peptide: a net positive molecule binds negatively charged surfaces, so borosilicate glass is a poorer choice than low-protein-binding polypropylene.

This is laboratory preparation chemistry, not dosing, administration, or protocol guidance of any kind.

Storage and stability

Store the lyophilized powder at -20 degrees C, sealed, desiccated and protected from light, and let a cold vial warm before opening. Reconstituted, hold at 2 to 8 degrees C, or aliquot and freeze rather than thawing repeatedly.

Sulfur is the named liability whichever form it takes, and the two failure modes are distinguishable by mass: sulfoxide formation adds sixteen units, while dimerisation through a free thiol gives a species near twice the molecular weight. Cold, sealed, dark storage limits both.

The high nitrogen count indicates asparagine or glutamine may sit among the basic residues, and both deamidate to their acidic counterparts, adding about one unit each and shifting the charge balance, so retention moves along with mass. The reaction needs water, so the dry solid is largely protected while solutions are not.

Without a sequence this page will not name positions for either liability.

These are storage conditions for the material, not dosing or administration guidance.

How B7-33 is tested

Reversed-phase HPLC establishes chromatographic purity as area percent. A basic, charged peptide of this size retains only moderately on a standard C18 column, so trifluoroacetic acid in the mobile phase helps both retention and peak shape.

Area percent is a chromatographic measure and not peptide content by weight. Solid-phase synthesis delivers a salt, and on a basic peptide the counter-ion is a substantial proportional share of the vial contents.

Mass spectrometry confirms identity against 2986.5. A result sixteen units high indicates oxidation of the methionine to the sulfoxide, which is the one modification this composition allows. A thiol-linked dimer near 5973 is not available here, because the sequence carries no cysteine.

These describe general methodology, not a claim about any particular batch.

Handling FAQ

Does the stated weight agree with the stated formula? Yes. C131H229N41O36S computes to 2986.58 against a stated 2986.5, agreement to within rounding. The deposited record for this CAS carries the same formula, so the specification is corroborated externally as well as internally.

Is there a disulfide bond to protect? No. The formula contains one sulfur, and an internal disulfide needs two. The sequence identifies that atom as a methionine and carries no cysteine, so the risk to manage is oxidation to the sulfoxide rather than any disulfide chemistry.

Full specifications for B7-33.

Shop lot-tested B7-33

Every batch is HPLC and MS-UPLC verified and ships with a batch-matched Certificate of Analysis.

View Product · B7-33

For mechanism and published findings, see the research article.

Read Research

Safety Data Sheet

16-section GHS format · hazard identification, handling, storage and disposal

Download SDS

More Handling References

Reference

BPC-157

What BPC-157 is chemically and how to handle it in the lab: pentadecapeptide structure, reconstitution, storage, stability, and verification.

Read Reference
Reference

GHK-Cu

What GHK-Cu is chemically and how to handle it in the lab: copper-complex structure, reconstitution, storage, stability, and verification.

Read Reference
Reference

KPV

What KPV is chemically and how to handle it in the lab: tripeptide structure, reconstitution, storage, stability, and verification.

Read Reference
Reference

LL-37

LL-37, CAS 154947-66-7, 4493.34 g/mol, purity greater than 99 percent. Cationic 37-residue peptide profile, reconstitution, storage, HPLC and MS verification.

Read Reference
Reference

TB-500

What TB-500 is chemically and how to handle it in the lab: peptide fragment structure, reconstitution, storage, stability, and verification.

Read Reference
Reference

Thymosin Beta-4

What Thymosin Beta-4 is chemically and how to handle it in the lab: 43 residue peptide structure, reconstitution, storage, stability, and verification.

Read Reference

Related Compounds

HPLC Verified
BPC-157 research peptide, >99% purity by HPLC, CAS 137525-51-0, lyophilized powder for in-vitro laboratory research, Pure Peptides

BPC-157

Mol. Wt.

1,419.55 g/mol

Purity

>99%

CAS No.

137525-51-0

from $29.00
HPLC Verified
TB-500 research peptide, >99% purity by HPLC, CAS 885340-08-9, lyophilized powder for in-vitro laboratory research, Pure Peptides

TB-500

Mol. Wt.

889.02 g/mol

Purity

>99%

CAS No.

885340-08-9

from $30.00
HPLC Verified
GHK-Cu (Copper Peptide) research peptide, >99% purity by HPLC, CAS 89030-95-5, lyophilized powder for in-vitro laboratory research, Pure Peptides

GHK-Cu (Copper Peptide)

Mol. Wt.

402.92 g/mol

Purity

>99%

CAS No.

89030-95-5

from $51.00

Your Cart

Your cart is empty

Add some research compounds to get started.

Browse Products